PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g04730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 112aa    MW: 12423.9 Da    PI: 10.5649
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g04730genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.52.3e-331672158
   CBFB_NFYA  1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                dep++VNaKQy++Il+RRq+Rak+e+ekkl  k+rkpylheSRh hAl+R+Rg+gGrF
  CA02g04730 16 DEPVFVNAKQYHGILRRRQSRAKAESEKKL-LKARKPYLHESRHLHALKRARGCGGRF 72
                79****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.1E-361475IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.5611575IPR001289Nuclear transcription factor Y subunit A
PfamPF020458.2E-281772IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.3E-231840IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068602040IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.3E-234972IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 112 aa     Download sequence    Send to blast
MGIQQAGVPL PSDAIDEPVF VNAKQYHGIL RRRQSRAKAE SEKKLLKARK PYLHESRHLH  60
ALKRARGCGG RFLTAKKTDN QQKQDESGDK SQVNTNLESG KDRIASSEND S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-241585171NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0133701e-148BT013370.1 Lycopersicon esculentum clone 135390R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016559381.12e-77PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1
RefseqXP_016559380.12e-77PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1
RefseqXP_016559379.12e-77PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1
RefseqXP_016559378.12e-77PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1
RefseqXP_016559377.12e-77PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1
RefseqXP_016559376.12e-77PREDICTED: nuclear transcription factor Y subunit A-7 isoform X1
SwissprotQ84JP12e-48NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
TrEMBLA0A0V0I9B01e-73A0A0V0I9B0_SOLCH; Putative ovule protein
TrEMBLK4B7W82e-73K4B7W8_SOLLC; Uncharacterized protein
STRINGSolyc02g069860.2.15e-73(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66502333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G30500.29e-41nuclear factor Y, subunit A7